PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PSME_00049587-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga
Family MYB_related
Protein Properties Length: 429aa    MW: 47788.2 Da    PI: 4.8147
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PSME_00049587-RAgenomePRSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.35.5e-16179222146
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                       r + ++eE+ l++++++++G++ W++Ia+ ++ gRt++++k++w++
  PSME_00049587-RA 179 RSKISPEEERLIIELHHRWGNR-WSRIAQNLP-GRTDNEIKNFWRT 222
                       56789*****************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500907.0623068IPR017877Myb-like domain
SuperFamilySSF466892.69E-63268IPR009057Homeodomain-like
SMARTSM007171.7E-534175IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.0E-173667IPR009057Homeodomain-like
CDDcd001677.13E-43768No hitNo description
SuperFamilySSF466895.13E-20159230IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.0E-17160180IPR009057Homeodomain-like
PROSITE profilePS500904.31160173IPR017877Myb-like domain
PROSITE profilePS5129424.117174228IPR017930Myb domain
SMARTSM007179.2E-15178226IPR001005SANT/Myb domain
PfamPF002495.6E-15180222IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.9E-23181228IPR009057Homeodomain-like
CDDcd001671.28E-12183222No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 429 aa     Download sequence    Send to blast
MQKLCMVSSA HLMANRASWW DGSDIEDVNE AETRKGPWTV EEDMQLIGSI SLHGEGRWSF  60
LARAAVRRDS LNPLDSPLPL VCSSPRKTLA GAPPLSVDGR GLSLVSPPLS SGLPLRSRSP  120
PSLISRLPSP DIPPSPSIVT LPRPPPRDND ALSDVSCLKR TGKSCRLRWV NYLRPDLKRS  180
KISPEEERLI IELHHRWGNR WSRIAQNLPG RTDNEIKNFW RTRMKGKLKV QAEKDNDGVD  240
ADNVIHFERS MGSYRLPVTS SQILSELDSA EPSSSFVRQN TEDITVQTNI TPDLQDDLSP  300
QVIPSSEGNY EYVLQAEKVH GHSETNDDGQ AGEAMQELEG SDNLFENSRL PYTFSVGSLV  360
TLLSSEFFAD GASQDCKMQP SSFHTVASPE AFSDSDSYLS CYSDVLWNMD ETDNGFIRSW  420
QSSEDGRLQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1msf_C4e-1916022837105C-Myb DNA-Binding Domain
1mse_C4e-1916022837105C-Myb DNA-Binding Domain
1gv2_A5e-1916022837105MYB PROTO-ONCOGENE PROTEIN
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G40350.11e-37myb domain protein 24